GET /api/protein/UniProt/A0A341CNL9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A341CNL9",
        "id": "A0A341CNL9_NEOAA",
        "source_organism": {
            "taxId": "1706337",
            "scientificName": "Neophocaena asiaeorientalis asiaeorientalis",
            "fullName": "Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)"
        },
        "name": "Globin domain-containing protein",
        "description": [
            "Involved in oxygen transport from the lung to the various peripheral tissues"
        ],
        "length": 142,
        "sequence": "MVLSPADKTNVKGTWAKIGNHSAEYGAEALERMFINFPSTKTYFSHFDLGHGSAQIKGHGKKVADALTKAVGHIDNLPDALSELSDLHAHKLRVDPVNFKLLSHCLLVTLALHLPADFTPSVHASLDKFLASVSTVLTSKYR",
        "proteome": "UP000252040",
        "gene": "LOC112409503",
        "go_terms": [
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019825",
                "name": "oxygen binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015671",
                "name": "oxygen transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005833",
                "name": "hemoglobin complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "479f10f36c30dd70c041c861502b6b89292a259d",
        "counters": {
            "domain_architectures": 26315,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26315
        }
    }
}