General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A341BP24",
        "id": "A0A341BP24_NEOAA",
        "source_organism": {
            "taxId": "1706337",
            "scientificName": "Neophocaena asiaeorientalis asiaeorientalis",
            "fullName": "Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)"
        },
        "name": "Farnesyl pyrophosphate synthase",
        "description": [
            "Key enzyme in isoprenoid biosynthesis which catalyzes the formation of farnesyl diphosphate (FPP), a precursor for several classes of essential metabolites including sterols, dolichols, carotenoids, and ubiquinones. FPP also serves as substrate for protein farnesylation and geranylgeranylation. Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate"
        ],
        "length": 353,
        "sequence": "MNGDQKLDVYAQERQDFIQHFSQIVKVLTEEDIGHPETGDAIARLKEVLEYNAIGGKYHRGLTVLVAFRELVEPRKQDAESLRRALTVGWCVELLQAFFVVSDDIMDSSLTRRGKICWYQKPGIGLDAINDAFLLEACVYRLLKFYCREQPYYMNLIELFLQSSYQTEIGQTLDLITAPQGNVDLGRFTEKRYKSIVKYKTAFYSFYLPVAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVMGKIGTDIQDNKCSWLVVQCLQRASPEQRQILQENYGQKEAEKVARVKALYEEMNLRAVFTQYEEHSYSRIMGLIEQYAAPLPPAIFLGLANKIYKRKK",
        "proteome": "UP000252040",
        "gene": "FDPS",
        "go_terms": [
            {
                "identifier": "GO:0004659",
                "name": "prenyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008299",
                "name": "isoprenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016765",
                "name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7d86fa062ed092e18d33fa27312ed76ddc71a30e",
        "counters": {
            "domain_architectures": 84087,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "sfld": 2,
                "panther": 1,
                "prosite": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 84087
        }
    }
}