General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A340Y7D4",
        "id": "A0A340Y7D4_LIPVE",
        "source_organism": {
            "taxId": "118797",
            "scientificName": "Lipotes vexillifer",
            "fullName": "Lipotes vexillifer (Yangtze river dolphin)"
        },
        "name": "FUN14 domain-containing protein 2",
        "description": [
            "Binds directly and specifically 1,2-Diacyl-sn-glycero-3-phospho-(1'-myo-inositol-3',4',5'-bisphosphate) (PIP3) leading to the recruitment of PIP3 to mitochondria and may play a role in the regulation of the platelet activation via AKT/GSK3B/cGMP signaling pathways. May act as transcription factor that regulates SREBP1 (isoform SREBP-1C) expression in order to modulate triglyceride (TG) homeostasis in hepatocytes"
        ],
        "length": 189,
        "sequence": "METSTPRAGIQLAPTVARHSAPYRAEPLQVSSRDELAEMAAASQGNFEGNFESLDLAELAKKQPWWRKLFGQESGPSAEKYSVATQLLIGGVTGWCTGFIFQKVGRLAATALGGGFFLLQLANHTGYIKVDWKRVEQDMKKAKEQLKVCKGSQTPVEVKSKADEVVSFVKKNVLVTGGFFGGFLLGMAS",
        "proteome": "UP000265300",
        "gene": "FUNDC2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "69224364f88145b7fc68cd582d3205020ece1303",
        "counters": {
            "domain_architectures": 5301,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5301
        }
    }
}