GET /api/protein/UniProt/A0A340XTE5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A340XTE5",
"id": "A0A340XTE5_LIPVE",
"source_organism": {
"taxId": "118797",
"scientificName": "Lipotes vexillifer",
"fullName": "Lipotes vexillifer (Yangtze river dolphin)"
},
"name": "Kallikrein-4",
"description": [
"Has a major role in enamel formation. Required during the maturation stage of tooth development for clearance of enamel proteins and normal structural patterning of the crystalline matrix"
],
"length": 253,
"sequence": "MSMAGNPWGWFLGHLLLSVTGSLAWSGGSHIINGEDCHPHSQPWQAALFLEKEFFCGGVLVHPQWVLSAAHCFQNSYTIRLGLHSLDDHEPGGQMMEAHLSIQHPEYNRPSFANDLMLIKLEEFVPQSDTIQNISIASQCPTAGDSCLISGWGRLANGRLPKVLQCVNISVVSEEICSELYAPVHHPSMFCAGGGQDQKDSCHGDSGGPLVCNGSLQGLVSFGQSPCGQPNMPGVYTNLCKFTDWIQKTIQAS",
"proteome": "UP000265300",
"gene": "KLK4",
"go_terms": [
{
"identifier": "GO:0004252",
"name": "serine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9eb5193692395549c59ea14a515b8bb2c75cc329",
"counters": {
"domain_architectures": 140214,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"pfam": 1,
"cdd": 1,
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140214
}
}
}