General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A340X8R6",
        "id": "A0A340X8R6_LIPVE",
        "source_organism": {
            "taxId": "118797",
            "scientificName": "Lipotes vexillifer",
            "fullName": "Lipotes vexillifer (Yangtze river dolphin)"
        },
        "name": "Sulfotransferase",
        "description": [
            "Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site"
        ],
        "length": 311,
        "sequence": "MAALLLGAVMLVVQLQLVPSRPAVPGAELGQPELVRKAATSQDEIWEGAAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSQGLGWYLSQMPFSSPHQLTVEKTPAYFTSPKVPERVHSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFSLRRIHIVDGDRLIRDPFPEIQKVERFLRLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVSRTFDWH",
        "proteome": "UP000265300",
        "gene": "HS3ST1",
        "go_terms": [
            {
                "identifier": "GO:0008146",
                "name": "sulfotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c3f904adb28054815298b5a4924ad2c008edc08c",
        "counters": {
            "domain_architectures": 55737,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 55737
        }
    }
}