GET /api/protein/UniProt/A0A340WDK0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A340WDK0",
"id": "A0A340WDK0_LIPVE",
"source_organism": {
"taxId": "118797",
"scientificName": "Lipotes vexillifer",
"fullName": "Lipotes vexillifer (Yangtze river dolphin)"
},
"name": "Myelin proteolipid protein",
"description": [
"This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin"
],
"length": 242,
"sequence": "MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATFVGITYALTIVWLLVFACSAVPVYIYFNTWTTCQSIASPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF",
"proteome": "UP000265300",
"gene": "PLP1",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0e9fe08eeafadfc70d0e5880430bb4634f380137",
"counters": {
"domain_architectures": 5719,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"panther": 1,
"pfam": 1,
"prosite": 2,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5719
}
}
}