GET /api/protein/UniProt/A0A318ZUE5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A318ZUE5",
        "id": "A0A318ZUE5_9EURO",
        "source_organism": {
            "taxId": "1450539",
            "scientificName": "Aspergillus saccharolyticus JOP 1030-1",
            "fullName": "Aspergillus saccharolyticus JOP 1030-1"
        },
        "name": "Chromatin modification-related protein EAF6",
        "description": [
            "Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair"
        ],
        "length": 356,
        "sequence": "MATPAPAQPVTAGGTASMPATQTGATATTPSHLRDVTQQLNADANANSNSNASNNTNHTTATTNPTSTSATPAPTTATATASAPGATPGTPGASSGSHPAASTSKNGIGAGAVPSTTDAIASTTASTTTATATAHRGLPYYEKLRRELRDTLQKKRLMDKSMAQLEDQIYRFEQSYLEETTAGNIIKGFDNYIKGSSTGGGLGAGGLSLSSGVGGGSGGGGGGGGSNAGGGGGGGGARRKAPVTEADRVFSRSSASYMRDSPAPSSAQTTPSHAPTPNSTYNGSSTGKAGNNGDAASSAANSVKGTSSKNKKKSGGGGNKDKSGGNSSNNTKVEDEDGTDADRPPTKRLKITYGRD",
        "proteome": "UP000248349",
        "gene": "BP01DRAFT_354485",
        "go_terms": [
            {
                "identifier": "GO:0000123",
                "name": "histone acetyltransferase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ea58ca9b12f062ad647d544945a543df359f073c",
        "counters": {
            "domain_architectures": 4751,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4751
        }
    }
}