HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A317W9M1",
"id": "A0A317W9M1_9EURO",
"source_organism": {
"taxId": "1448321",
"scientificName": "Aspergillus heteromorphus CBS 117.55",
"fullName": "Aspergillus heteromorphus CBS 117.55"
},
"name": "D-xylose reductase [NAD(P)H]",
"description": [
"Catalyzes the initial reaction in the xylose utilization pathway by reducing D-xylose into xylitol. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway"
],
"length": 319,
"sequence": "MASPTVKLNSGYDMPLVGFGLWKVNNDTCADQVYHAIKEGYRLFDGACDYGNEVEAGQGIARAIKDGLVQRSDLFIVSKLWNSFHDGPQVEPICRKQLADWGIDYFDLYIVHFPIALKYVDPAIRYPPGWKSASDELEFSPASIQETWTAMESLVDKGLARSIGISNFSAQLVMDLLRYARIRPATLQIEHHPYLTQTRLVDFAQKQGLTVTAYSSFGPLSFLELDVRDAVSTPPLFEHEVVRKVAQRCGRTPAQVLLRWATQRGVAVIPKSNDPQRLRQNLDVTGWDLEEGEVQAIAALDQGLRFNDPIGYGLDIPIF",
"proteome": "UP000247233",
"gene": "BO70DRAFT_361774",
"go_terms": [
{
"identifier": "GO:0032866",
"name": "D-xylose reductase (NADPH) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042843",
"name": "D-xylose catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e96b765c85e65c75beacfc1efe2818f689e0515d",
"counters": {
"domain_architectures": 291149,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 3,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 291149
}
}
}