GET /api/protein/UniProt/A0A316UF65/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A316UF65",
"id": "A0A316UF65_9BASI",
"source_organism": {
"taxId": "1684307",
"scientificName": "Pseudomicrostroma glucosiphilum",
"fullName": "Pseudomicrostroma glucosiphilum"
},
"name": "Iron-sulfur cluster assembly protein",
"description": [
"Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins"
],
"length": 207,
"sequence": "MLRSALRTATATAGASTSRLVATPAVSTSVRPSLSQASKLAAVPTVSSNRLYHEKVIDHYENPRNVGSFLKTEKNVGIGLVGAPACGDVMKLSIKVNEAGIIEDVRFKTFGCGSAIASSSYMTERVKGMTLEEAGKIKNTEIAQELSLPPVKLHCSMLAEDAIKAAIRDYDSKRKATGNMKAGHIDVSQSVTTGQTTATAHVGSGTV",
"proteome": "UP000245942",
"gene": "BCV69DRAFT_279861",
"go_terms": [
{
"identifier": "GO:0005506",
"name": "iron ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016226",
"name": "iron-sulfur cluster assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1a14465eba7d2532ef70113b6acb6327d7aa9427",
"counters": {
"domain_architectures": 26938,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26938
}
}
}