GET /api/protein/UniProt/A0A2Z6G1H5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Z6G1H5",
        "id": "A0A2Z6G1H5_NEPCI",
        "source_organism": {
            "taxId": "94400",
            "scientificName": "Nephotettix cincticeps",
            "fullName": "Nephotettix cincticeps (Green rice leafhopper)"
        },
        "name": "NADH:ubiquinone reductase (H(+)-translocating)",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 136,
        "sequence": "LIRFFNTKYFINDFLIYVSIVTLIMSSLCANYEFDLKKIIALSTLSQLGXMMSSLFMGMVEMTFFHLLSHAMFKSLLFLCSGIIIHLMGGCQDIRFMGSICYSMPLTSCCLNIXNMSLCGFPFLSGXYSKDLIIDS",
        "proteome": null,
        "gene": "ND5",
        "go_terms": [
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042773",
                "name": "ATP synthesis coupled electron transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "30faf52ccf77815d26cefd5a8a86610417a47c43",
        "counters": {
            "domain_architectures": 148734,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 148734
        }
    }
}