GET /api/protein/UniProt/A0A2Z5VA99/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2Z5VA99",
"id": "A0A2Z5VA99_9SOLA",
"source_organism": {
"taxId": "418041",
"scientificName": "Calibrachoa hybrid cultivar",
"fullName": "Calibrachoa hybrid cultivar"
},
"name": "Phytoene dehydrogenase",
"description": [
"Converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene with a concomitant isomerization of two neighboring double bonds at the C9 and C9' positions from trans to cis"
],
"length": 326,
"sequence": "ARDVLGGKIAAWKDDDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPSKPGEFSRFDFPEALPAPINGILAILKNNEMLTWPEKVKFAIGLLPAMLGGQPYVEAQDGISVKDWMRKQGVPDRVTDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVEHIESKGGQVRLNSRIRNIELNEDGSVKCFILNNGTSIEGDAFVFAAPVDIFKLLLPEDWKEIPYFQKLEKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSVTCKEYYNPNQSMLELVFAPAEEW",
"proteome": null,
"gene": "PDS",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016166",
"name": "phytoene dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016117",
"name": "carotenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5b5f43762a8111a79c1821931049e93de119ed5a",
"counters": {
"domain_architectures": 114707,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 114707
}
}
}