GET /api/protein/UniProt/A0A2Z5VA99/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Z5VA99",
        "id": "A0A2Z5VA99_9SOLA",
        "source_organism": {
            "taxId": "418041",
            "scientificName": "Calibrachoa hybrid cultivar",
            "fullName": "Calibrachoa hybrid cultivar"
        },
        "name": "Phytoene dehydrogenase",
        "description": [
            "Converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene with a concomitant isomerization of two neighboring double bonds at the C9 and C9' positions from trans to cis"
        ],
        "length": 326,
        "sequence": "ARDVLGGKIAAWKDDDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPSKPGEFSRFDFPEALPAPINGILAILKNNEMLTWPEKVKFAIGLLPAMLGGQPYVEAQDGISVKDWMRKQGVPDRVTDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVEHIESKGGQVRLNSRIRNIELNEDGSVKCFILNNGTSIEGDAFVFAAPVDIFKLLLPEDWKEIPYFQKLEKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSVTCKEYYNPNQSMLELVFAPAEEW",
        "proteome": null,
        "gene": "PDS",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016166",
                "name": "phytoene dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016117",
                "name": "carotenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5b5f43762a8111a79c1821931049e93de119ed5a",
        "counters": {
            "domain_architectures": 114707,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 114707
        }
    }
}