HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2Z4Z3E3",
"id": "A0A2Z4Z3E3_9EURO",
"source_organism": {
"taxId": "1506166",
"scientificName": "Penicillium jiangxiense",
"fullName": "Penicillium jiangxiense"
},
"name": "3-hydroxy-3-methylglutaryl coenzyme A reductase",
"description": null,
"length": 114,
"sequence": "AMGMNMISKGCEKALDVMTKECGFDDMSIISLSGNFCTDKKSAAINWTDGRGKSVVAEAIIPGEVVKSVLKSDVDALVELNVSKNLIGSAMAGSLGGFNAHASNIVSAIFMATG",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004420",
"name": "hydroxymethylglutaryl-CoA reductase (NADPH) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015936",
"name": "coenzyme A metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e774b6d1fcacbe8f79f643b09132aeac5a41b071",
"counters": {
"domain_architectures": 10786,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 10786
}
}
}