General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Y9RCW0",
        "id": "A0A2Y9RCW0_TRIMA",
        "source_organism": {
            "taxId": "127582",
            "scientificName": "Trichechus manatus latirostris",
            "fullName": "Trichechus manatus latirostris (Florida manatee)"
        },
        "name": "Apoptosis regulator Bcl-2",
        "description": [
            "Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release"
        ],
        "length": 188,
        "sequence": "MAHAGRTGYDNREIVMKYIHYKLSQRGYEWEAGDASAASPEAAPEPGVFSSPPDAPRGPAARTSPLPPAPAAQPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWGIF",
        "proteome": "UP000248480",
        "gene": "BCL2",
        "go_terms": [
            {
                "identifier": "GO:0042981",
                "name": "regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043066",
                "name": "negative regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e6df88747055402b85860b0fcaeda48c25af010f",
        "counters": {
            "domain_architectures": 1961,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 2,
                "profile": 2,
                "cdd": 1,
                "panther": 1,
                "pfam": 2,
                "prosite": 3,
                "prints": 2,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1961
        }
    }
}