GET /api/protein/UniProt/A0A2Y9QU72/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Y9QU72",
        "id": "A0A2Y9QU72_TRIMA",
        "source_organism": {
            "taxId": "127582",
            "scientificName": "Trichechus manatus latirostris",
            "fullName": "Trichechus manatus latirostris (Florida manatee)"
        },
        "name": "Sterol carrier protein 2",
        "description": [
            "Mediates the transfer of all common phospholipids, cholesterol and gangliosides from the endoplasmic reticulum to the plasma membrane. May play a role in regulating steroidogenesis. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol. Also binds fatty acids and fatty acyl Coenzyme A (CoA) such as phytanoyl-CoA. Involved in the regulation phospholipid synthesis in endoplasmic reticulum enhancing the incorporation of exogenous fatty acid into glycerides. Seems to stimulate the rate-limiting step in phosphatidic acid formation mediated by GPAT3. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs",
            "Plays a crucial role in the peroxisomal oxidation of branched-chain fatty acids. Catalyzes the last step of the peroxisomal beta-oxidation of branched chain fatty acids and the side chain of the bile acid intermediates di- and trihydroxycoprostanic acids (DHCA and THCA). Also active with medium and long straight chain 3-oxoacyl-CoAs. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol and transfers phosphatidylcholine and 7-dehydrocholesterol between membrances, in vitro. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs"
        ],
        "length": 335,
        "sequence": "MESREVFNFLTVLQCCPTSDGAAAAVLASEAFVQKYGLQSKAVEILAQEMVTDLPSSFEEKSVIKMVGFDMTKEAARKCYEKSGLRPSDIDVIELHDCFSSNELLSYEALGLCPEGQGGKLVDRGDNTYGGKWVINPSGGLIAKGHPLGATGLGQCAELCWQLRGEAGKRQVPGAKVALQHNIGLGGAVVVTVYKMGFPEAARTHQIEAVPTSSAFDGFKANLVFKEIEKKLEEEGEEFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVHPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKITGNMGMAMKLQNLQLQPGKAKL",
        "proteome": "UP000248480",
        "gene": "SCP2",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bd7283b37221e08bf274091af4d30ab79778a848",
        "counters": {
            "domain_architectures": 143,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 143
        }
    }
}