GET /api/protein/UniProt/A0A2Y9M925/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2Y9M925",
"id": "A0A2Y9M925_DELLE",
"source_organism": {
"taxId": "9749",
"scientificName": "Delphinapterus leucas",
"fullName": "Delphinapterus leucas (Beluga whale)"
},
"name": "Myogenic factor",
"description": [
"Induces fibroblasts to differentiate into myoblasts. Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation"
],
"length": 255,
"sequence": "MDMMDGCQFSPSEYFYDGSCIPSPEGEFGDEFEPRVAAFGAHKADLQGSDEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSSCSDGMPECNSPVWSRKSSSFDSVYCPDVPNVYATDKSSLSSLDCLSSIVDRITNSEQPGLPLQDPASLSPVASTDSQPATQGASNSRLIYHVL",
"proteome": "UP000248483",
"gene": "MYF5",
"go_terms": [
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007517",
"name": "muscle organ development",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e91b6ed8a74598fdec5faf2c1d50b492c54e6120",
"counters": {
"domain_architectures": 1802,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 2,
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"pfam": 3,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1802
}
}
}