HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2Y9KD24",
"id": "A0A2Y9KD24_ENHLU",
"source_organism": {
"taxId": "391180",
"scientificName": "Enhydra lutris kenyoni",
"fullName": "Enhydra lutris kenyoni (northern sea otter)"
},
"name": "3-ketodihydrosphingosine reductase",
"description": [
"Catalyzes the reduction of 3'-oxosphinganine (3-ketodihydrosphingosine/KDS) to sphinganine (dihydrosphingosine/DHS), the second step of de novo sphingolipid biosynthesis"
],
"length": 332,
"sequence": "MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKHSINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFERLMSVNYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAEENKTKPLETRLISETVSVCKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMTQRAKSEIADKTA",
"proteome": "UP000248482",
"gene": "LOC111154250",
"go_terms": [
{
"identifier": "GO:0047560",
"name": "3-dehydrosphinganine reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006666",
"name": "3-keto-sphinganine metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030148",
"name": "sphingolipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a0c95b509a3fe852564663f48768d986938c9d65",
"counters": {
"domain_architectures": 599639,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 599639
}
}
}