GET /api/protein/UniProt/A0A2Y9IL22/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2Y9IL22",
"id": "A0A2Y9IL22_ENHLU",
"source_organism": {
"taxId": "391180",
"scientificName": "Enhydra lutris kenyoni",
"fullName": "Enhydra lutris kenyoni (northern sea otter)"
},
"name": "Methionine adenosyltransferase 2 subunit beta",
"description": [
"Regulatory subunit of S-adenosylmethionine synthetase 2, an enzyme that catalyzes the formation of S-adenosylmethionine from methionine and ATP. Regulates MAT2A catalytic activity by changing its kinetic properties, increasing its affinity for L-methionine. Can bind NADP (in vitro)"
],
"length": 323,
"sequence": "MPEMPEDMEQEEVNVPNRRVLITGATGLLGRAVYKEFKQNNWHAFGCGFRRARPKFEQINLLDSEAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAALIGAFLIYISSDYVFDGTNPPYREEDVPSPLNLYGKTKLEGEKAVLENNLGAAVLRIPVLYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCTKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH",
"proteome": "UP000248482",
"gene": "LOC111141243",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0aa11ba7ec445bed3b4edd0553555ef64beee085",
"counters": {
"domain_architectures": 31956,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 31956
}
}
}