GET /api/protein/UniProt/A0A2Y9IL22/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Y9IL22",
        "id": "A0A2Y9IL22_ENHLU",
        "source_organism": {
            "taxId": "391180",
            "scientificName": "Enhydra lutris kenyoni",
            "fullName": "Enhydra lutris kenyoni (northern sea otter)"
        },
        "name": "Methionine adenosyltransferase 2 subunit beta",
        "description": [
            "Regulatory subunit of S-adenosylmethionine synthetase 2, an enzyme that catalyzes the formation of S-adenosylmethionine from methionine and ATP. Regulates MAT2A catalytic activity by changing its kinetic properties, increasing its affinity for L-methionine. Can bind NADP (in vitro)"
        ],
        "length": 323,
        "sequence": "MPEMPEDMEQEEVNVPNRRVLITGATGLLGRAVYKEFKQNNWHAFGCGFRRARPKFEQINLLDSEAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAALIGAFLIYISSDYVFDGTNPPYREEDVPSPLNLYGKTKLEGEKAVLENNLGAAVLRIPVLYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCTKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH",
        "proteome": "UP000248482",
        "gene": "LOC111141243",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0aa11ba7ec445bed3b4edd0553555ef64beee085",
        "counters": {
            "domain_architectures": 31956,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31956
        }
    }
}