HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2Y9GGT7",
"id": "A0A2Y9GGT7_NEOSC",
"source_organism": {
"taxId": "29088",
"scientificName": "Neomonachus schauinslandi",
"fullName": "Neomonachus schauinslandi (Hawaiian monk seal)"
},
"name": "L-selectin",
"description": [
"Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia"
],
"length": 372,
"sequence": "MIFPWKCQSSQRGSWNIFKLWVWTVLCCDFLARHGTNGWTYHYSEKSMNWARARRYCQENYTDLVAIQNKGEIEYLERTLPHSQTYYWIGIRKVGGIWTWVGTNKSLTKEAENWGDGEPNNKKSKEDCVEIYIKRMKDAGKWNDDSCYKQKKALCYTASCQPWSCGNHGECVETINNYTCNCDVGYYGPQCQFVIQCEPLEAPDLGSMDCSHPLGNFSFISICTFNCSEGTDLIGIEETTCGPFGNWSSQEPTCEMIQCEPLEAPDLGTMDCSHPLGNFSFTSMCTFNCSEETELIGERKTICGSSGIWSSPSPKCQKVDRSFSMIKKGDYNPVFIPVAVMVTAFAGLAFIIWLARRLKKGKESQESTNDPY",
"proteome": "UP000248481",
"gene": "SELL",
"go_terms": [
{
"identifier": "GO:0007155",
"name": "cell adhesion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050900",
"name": "leukocyte migration",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "12ed80bb2e3684070be601d8e82a843abe632fe4",
"counters": {
"domain_architectures": 45,
"entries": 33,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 3,
"profile": 3,
"ssf": 3,
"cathgene3d": 3,
"pfam": 3,
"cdd": 2,
"pirsf": 1,
"panther": 1,
"prosite": 3,
"prints": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 45
}
}
}