General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Y9GA83",
        "id": "A0A2Y9GA83_NEOSC",
        "source_organism": {
            "taxId": "29088",
            "scientificName": "Neomonachus schauinslandi",
            "fullName": "Neomonachus schauinslandi (Hawaiian monk seal)"
        },
        "name": "Cytochrome P450 3A",
        "description": [
            "Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics"
        ],
        "length": 503,
        "sequence": "MDLIPSFSMETWLLLATSLVLFYLYGTSTHGLFKKLGIPGPTPLPFLGNILDYHKGFWNIDKAYFKKYGRFWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRFLGPVGFMKNSIALSEDEEWKRIRTLLSPTFTSGKMKEMFSIIGQYGDVLVRNLRKEAEKGKPINLKDIFGAYSMDVITSTSFGVNTDSLNNPQDPFVENAKKLFRFEFFDPLLFLIVLFPFLTPVFEILNICVFPKSVTDFFTKSVKRMKECRLKDEQKHRLDFLQLMINSQNSKETDTHKALSDLELVAQSMTFLFAGYEPTSTALSFFAYALATHPDVQQKLQEEIDATFPNQALPTYNDLVQMEYLDMVLHESFRLYPVTGRLERICKKDVEIHGVFIPKGTVVMVPVFTLHQDLDLWPEAEEFRPERFSKKNKDSINPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSFKPCKETQIHLRMSTQGIIKTEKPIILKVEPRDGSVDRA",
        "proteome": "UP000248481",
        "gene": "LOC110571974",
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016712",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a02e61ba6c64bb9a9c779746e03a6c43264a16fb",
        "counters": {
            "domain_architectures": 520850,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 3,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 520850
        }
    }
}