General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Y9E6S2",
        "id": "A0A2Y9E6S2_TRIMA",
        "source_organism": {
            "taxId": "127582",
            "scientificName": "Trichechus manatus latirostris",
            "fullName": "Trichechus manatus latirostris (Florida manatee)"
        },
        "name": "Metalloprotease TIKI",
        "description": [
            "Metalloprotease that acts as a negative regulator of the Wnt signaling pathway by mediating the cleavage of the N-terminal residues of a subset of Wnt proteins. Following cleavage, Wnt proteins become oxidized and form large disulfide-bond oligomers, leading to their inactivation"
        ],
        "length": 514,
        "sequence": "MRPWSWFLLPTLCLRPTGAAQPRGVLASANCELKPQQSELNSFLWTIKRDLLSYFFGTIHVPYTRVWDFIPDNSKEAFQQSSIVYLELDLTNPYTISALTSCQMLLQGENLQDVLPRDIYCCLKCHLEYVKLTMPSWMTPDQHGKGLYADYLFSAITGNWERKRPIWVMLMVNSLTEVDIKSCGVPVLDLYLVQEAERLRKQTGAVEKVEEQCHPLNGLNFSQVILALNQKLLQQESLXAGSVQIPYTMKDLIKHYNCGDLRSIIFSHDSSQVPNFINATLPPQECVTAQEIDSYFRQELIYKRNERMGKRVKALLEEFPNKSFLFAFGAGHFMGNNTVLDVLRREGYEVEHAPAGQPINKGRSKAPSPNPALSAIFAPEVPAPTPPVPEAGSEAPLLLPPHASSSGSADLPIXAERKFRKKWRRLLRRQQLREFSELWVRLEESAVVPHLQVPILDRHISTELRFPRQGHFHHSQMVASHACLSLWTPVFWVLVLALQTDSPPVMAGAARPRP",
        "proteome": "UP000248480",
        "gene": "TRABD2A",
        "go_terms": [
            {
                "identifier": "GO:0004175",
                "name": "endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030178",
                "name": "negative regulation of Wnt signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "65094d78d77d68ebfb4b6056561de2a19ab2ee0e",
        "counters": {
            "domain_architectures": 17551,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17551
        }
    }
}