General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Y9DQQ2",
        "id": "A0A2Y9DQQ2_TRIMA",
        "source_organism": {
            "taxId": "127582",
            "scientificName": "Trichechus manatus latirostris",
            "fullName": "Trichechus manatus latirostris (Florida manatee)"
        },
        "name": "Protein phosphatase",
        "description": [
            "Protein phosphatase that plays an essential role in mitochondrial metabolism and biogenesis. Positively regulates biosynthesis of the ubiquinone, coenzyme Q. Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation. Serves as a crucial sensor for mitophagy, though the underlying mechanism remains ambiguous. May dephosphorylate BNIP3 and NIX and thereby directly regulates mitophagy receptor function and stability. Alternatively, promotes SCF-FBXL4-dependent ubiquitination and degradation of BNIP3 and NIX independently of its catalytic activity to restrain mitophagy"
        ],
        "length": 305,
        "sequence": "MFSVLSYGRLVARAVLGSLSQTDSRAGSGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD",
        "proteome": "UP000248480",
        "gene": "PPTC7",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0abb29b8ef1ef714e7ffbfffd508d471afe7f750",
        "counters": {
            "domain_architectures": 27770,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "smart": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27770
        }
    }
}