HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2X2HNY7",
"id": "A0A2X2HNY7_SHIDY",
"source_organism": {
"taxId": "622",
"scientificName": "Shigella dysenteriae",
"fullName": "Shigella dysenteriae"
},
"name": "Homoserine O-succinyltransferase",
"description": [
"Transfers a succinyl group from succinyl-CoA to L-homoserine, forming succinyl-L-homoserine"
],
"length": 309,
"sequence": "MPIRVPDELPAVNFLREENVFVMTTSRASGQEIRPLKVLILNLMPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQEQNFDGLIVTGAPLGLVEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYEHHILHPHALLTRGFDDSFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLFASKDKRIAFVTGHPEYDAQTLAQEFFRDVEAGLDPDVPYNYFPHNDPQNTPRASWRSHGNLLFTNWLNYYVYQITPYDLRHMNPTLD",
"proteome": null,
"gene": "metA",
"go_terms": [
{
"identifier": "GO:0008899",
"name": "homoserine O-succinyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019281",
"name": "L-methionine biosynthetic process from homoserine via O-succinyl-L-homoserine and cystathionine",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a7fed6e94dfbd44cfc6501254b2649dde18f54d8",
"counters": {
"domain_architectures": 8981,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 8981
}
}
}