GET /api/protein/UniProt/A0A2X2GPM3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2X2GPM3",
        "id": "A0A2X2GPM3_9GAMM",
        "source_organism": {
            "taxId": "137545",
            "scientificName": "Serratia quinivorans",
            "fullName": "Serratia quinivorans"
        },
        "name": "Flagellar transcriptional regulator FlhD",
        "description": [
            "Functions in complex with FlhC as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways"
        ],
        "length": 116,
        "sequence": "MGTSELLKHIYDINLSYLLLAQRLINDEKASAMFRLGIDETMADALAQLTLPQMVKLAETNQLVCQFRFNDHQTIERLTKESRVDDLQQIHTGILLSSHLLQELSAKDGSATKKRA",
        "proteome": "UP001558101",
        "gene": "flhD",
        "go_terms": [
            {
                "identifier": "GO:0044780",
                "name": "bacterial-type flagellum assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045893",
                "name": "positive regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "545e7829fd3ae9dc83824c4d11e8cbe5620ee846",
        "counters": {
            "domain_architectures": 3382,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3382
        }
    }
}