GET /api/protein/UniProt/A0A2W2EK23/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2W2EK23",
        "id": "A0A2W2EK23_9ACTN",
        "source_organism": {
            "taxId": "2666298",
            "scientificName": "Spongiactinospora gelatinilytica",
            "fullName": "Spongiactinospora gelatinilytica"
        },
        "name": "Nucleoside diphosphate kinase",
        "description": [
            "Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate"
        ],
        "length": 136,
        "sequence": "MSERTLVLIKPDGVARGLVGDVIGRIERKGLTIVAMDLRTLDADTAKAHYAEHSGKPFFDSLVEFITSGPLVAMVVEGPRAIEAFRGLAGLTDPVKAAPGTIRGDHALEIGENIVHGSDAPESASREIKIFFPDRF",
        "proteome": "UP000248544",
        "gene": "ndk",
        "go_terms": [
            {
                "identifier": "GO:0004550",
                "name": "nucleoside diphosphate kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006183",
                "name": "GTP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006228",
                "name": "UTP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006241",
                "name": "CTP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cac8064c040caff7c196d0f0b27a2c0d5516558b",
        "counters": {
            "domain_architectures": 37588,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37588
        }
    }
}