GET /api/protein/UniProt/A0A2W1FDJ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2W1FDJ5",
        "id": "A0A2W1FDJ5_9PLEO",
        "source_organism": {
            "taxId": "45151",
            "scientificName": "Pyrenophora tritici-repentis",
            "fullName": "Pyrenophora tritici-repentis"
        },
        "name": "Ornithine decarboxylase antizyme",
        "description": [
            "Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome"
        ],
        "length": 153,
        "sequence": "MTATATITNDYGIDARRYSDSSSDSDVPEMVRFDEVKGSITDYIEMWDYVGGIRFRGFVAEKEDQRAMFVFFDEPVIKGDIKAGLMALLELCEVDYFSCDRLVLCIDRQVDQAARNNLTKDLGWIGFGLTTLDEFSGGEELTSEKWLFMDMET",
        "proteome": null,
        "gene": "PtrM4_006440",
        "go_terms": [
            {
                "identifier": "GO:0008073",
                "name": "ornithine decarboxylase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d6c484e7a6946119616884c4e0ba4b063ff4f9a0",
        "counters": {
            "domain_architectures": 3670,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3670
        }
    }
}