GET /api/protein/UniProt/A0A2V3KKS8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2V3KKS8",
"id": "A0A2V3KKS8_KLEVA",
"source_organism": {
"taxId": "244366",
"scientificName": "Klebsiella variicola",
"fullName": "Klebsiella variicola"
},
"name": "Autoinducer 2 import system permease protein LsrC",
"description": [
"Part of the ABC transporter complex LsrABCD involved in autoinducer 2 (AI-2) import. Probably responsible for the translocation of the substrate across the membrane"
],
"length": 344,
"sequence": "MKTLLKNRELSAFFAIVALFAVLVALNPAYFSLQTLAMIFASSQILCLLALGATLVMLTRNIDVSVGSTVGLCAIAVGVALNNGYGLATAIAFALAIGALAGAFNGLLVVGLRIPAIVATLGTLGLYRGVMLLWTGGKWIEGLPDSLKSLSEPAFIGVSPLGWLVLALLLAGGWLLSRTAFGRDFYAVGDNLAAARQLGVAVNRTRMLAFTLNGMLAACAGIVFAAQIGFVPNQTGSGLEMKAIAACVLGGISLLGGTGTLLGAFLGAFFLTQIDTVLVLFRLPAWWNDFIAGLVLLGVLVLDGRLRQALARHQRALKYSRFQPGNKGGKQVARFPERKSKEVA",
"proteome": null,
"gene": "lsrC",
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1f4945418929b9761eda031e21626d80f6bb8489",
"counters": {
"domain_architectures": 257120,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 257120
}
}
}