General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2U9C2J2",
        "id": "A0A2U9C2J2_SCOMX",
        "source_organism": {
            "taxId": "52904",
            "scientificName": "Scophthalmus maximus",
            "fullName": "Scophthalmus maximus (Turbot)"
        },
        "name": "Profilin",
        "description": [
            "Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG"
        ],
        "length": 227,
        "sequence": "MAARRTTARAEGFCEDYTQALVRLQRLLFIAETRRKPGRDGAGGFLLAGGPLKPPIKHSSVARETFVTPTLNRLTFFFPPILELNFTNMSWQSYVDNLMADGSCQDSAIVGYTDAKYVWASFVGGTFAKITPEEIDVLVGKDREGFFTGGLTLGSKKCSVIRDSLNIDGDWTMDIRTKSQGGEPTYNISLGKAGKALVFVMGKEGVHGGQLNKKAFTMVDYLRKTGY",
        "proteome": "UP000246464",
        "gene": "LOC118318111",
        "go_terms": [
            {
                "identifier": "GO:0003779",
                "name": "actin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030036",
                "name": "actin cytoskeleton organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9a5573d0ebb5c532b4444f54b2266218d455b937",
        "counters": {
            "domain_architectures": 10196,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10196
        }
    }
}