General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2U8PYA9",
        "id": "A0A2U8PYA9_9BRAD",
        "source_organism": {
            "taxId": "1404768",
            "scientificName": "Bradyrhizobium amphicarpaeae",
            "fullName": "Bradyrhizobium amphicarpaeae"
        },
        "name": "Chlorophyllide a reductase iron protein subunit X",
        "description": null,
        "length": 331,
        "sequence": "MNVVPNINMKDALRAEASIEPDAPLVTPVTKETQIIAIYGKGGIGKSFTLANLSYMMAQQGKKVLLIGCDPKSDTTSLLFGGRACPTIIETSSKKKLAGEEVKIGDVCFKRDGVFAMELGGPEVGRGCGGRGIIHGFELLEKLGFHEWGFDYVLLDFLGDVVCGGFGLPIARDMCQKVIVVGSNDLQSLYVANNVCSAVEYFRKLGGNVGVAGMVINKDDGTGEAAAFAQTVGIPVLAAIPADDDIRKKSANYEIIGLPGGQWSSLFEQLATNVGLAPPVRPTPLTQDGLLGLFKGEVVGRGVVLEPATMEDMCGKSVVDKPSLEVVYDAA",
        "proteome": "UP000215884",
        "gene": "CIT40_23940",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016628",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030494",
                "name": "bacteriochlorophyll biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "071df9b5c0283bbb9290ef29639d54eb5a20356f",
        "counters": {
            "domain_architectures": 24594,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24594
        }
    }
}