GET /api/protein/UniProt/A0A2U8P671/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2U8P671",
"id": "A0A2U8P671_9BRAD",
"source_organism": {
"taxId": "931866",
"scientificName": "Bradyrhizobium ottawaense",
"fullName": "Bradyrhizobium ottawaense"
},
"name": "RNA pyrophosphohydrolase",
"description": [
"Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage"
],
"length": 168,
"sequence": "MARYEDLPYRTCVGVMLINTEGRVFIGRRAGGIEHVDDTHVWQMPQGGVDPGEDTWEAAKRELYEETSVRSVERLGEVPDWLTYDIPRTVAGRAWKGRYRGQRQKWFAVRFTGKDSEINVANPGGGGHKAEFVSWRWEPMKNLTGLIIPFKRPVYERVVQEFSALADQ",
"proteome": "UP001565369",
"gene": "rppH",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "752b3b6d9807717ea1f029db1420a2538cb188ca",
"counters": {
"domain_architectures": 250306,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 250306
}
}
}