GET /api/protein/UniProt/A0A2U3Z083/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2U3Z083",
"id": "A0A2U3Z083_LEPWE",
"source_organism": {
"taxId": "9713",
"scientificName": "Leptonychotes weddellii",
"fullName": "Leptonychotes weddellii (Weddell seal)"
},
"name": "Mitochondrial ornithine transporter 1",
"description": [
"Mitochondrial ornithine-citrulline antiporter. Catalyzes the exchange between cytosolic ornithine and mitochondrial citrulline plus an H(+), the proton compensates the positive charge of ornithine thus leading to an electroneutral transport. Plays a crucial role in the urea cycle, by connecting the cytosolic and the intramitochondrial reactions of the urea cycle. Lysine and arginine are also transported by the antiport mechanism. In addition, catalyzes an electroneutral exchange of ornithine or lysine for H(+), a reaction driven by the pH gradient across the inner membrane"
],
"length": 350,
"sequence": "MLKTLFHGLLMFSVADEKSAANPSIAPSSSLEKQALGEAAYLSFPRVFDAAFSNSTLVLEKTSVLVLGGTACVLTGQPFDTLKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVVGLEKQARLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMESSGKIARSQNTVWSVVKSVLRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCVKSRIQVLSMSGKQAGFIGTFISIVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMSQFEAY",
"proteome": "UP000245341",
"gene": "LOC102728592",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}