General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2U3YJ52",
        "id": "A0A2U3YJ52_LEPWE",
        "source_organism": {
            "taxId": "9713",
            "scientificName": "Leptonychotes weddellii",
            "fullName": "Leptonychotes weddellii (Weddell seal)"
        },
        "name": "Promotilin",
        "description": [
            "Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle"
        ],
        "length": 116,
        "sequence": "MVSRKAVTVLLVVHVAAMLASQTEAFVPIFTHSELQKIREKERNRGQKKSLVLQKRSEEVGPLDPLEPTEEEENQVIKLTAPVEIGMKMNSRQLEKYQAALEGLLSEALLSTQNDE",
        "proteome": "UP000245341",
        "gene": "MLN",
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "79b597a78df8c12991d4b42cf1c5ee5883a17c75",
        "counters": {
            "domain_architectures": 730,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 730
        }
    }
}