GET /api/protein/UniProt/A0A2U3XHW7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2U3XHW7",
        "id": "A0A2U3XHW7_LEPWE",
        "source_organism": {
            "taxId": "9713",
            "scientificName": "Leptonychotes weddellii",
            "fullName": "Leptonychotes weddellii (Weddell seal)"
        },
        "name": "Guided entry of tail-anchored proteins factor",
        "description": [
            "Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1/WRB, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Required for the stability of GET1. Stimulates calcium signaling in T cells through its involvement in elevation of intracellular calcium. Essential for the survival of peripheral follicular B cells"
        ],
        "length": 296,
        "sequence": "MEPGTVAPDSGDRPGAPATSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEEGQTKSKQQDSDKLNPLTIPSVSKRVVLGDSVSTGTTDQQSGVAEVKGTQLGDKLDSLIKPPECNNDVNLELRQRNRGDLTADTVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPNQEDGNTTEEFDSFRIFRLVGCALLAFGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLNYWGSEVP",
        "proteome": "UP000245341",
        "gene": "CAMLG",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0c3e162740490677398d7c4defb23e40fe496de4",
        "counters": {
            "domain_architectures": 964,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 964
        }
    }
}