GET /api/protein/UniProt/A0A2U3XHW7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2U3XHW7",
"id": "A0A2U3XHW7_LEPWE",
"source_organism": {
"taxId": "9713",
"scientificName": "Leptonychotes weddellii",
"fullName": "Leptonychotes weddellii (Weddell seal)"
},
"name": "Guided entry of tail-anchored proteins factor",
"description": [
"Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1/WRB, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Required for the stability of GET1. Stimulates calcium signaling in T cells through its involvement in elevation of intracellular calcium. Essential for the survival of peripheral follicular B cells"
],
"length": 296,
"sequence": "MEPGTVAPDSGDRPGAPATSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEEGQTKSKQQDSDKLNPLTIPSVSKRVVLGDSVSTGTTDQQSGVAEVKGTQLGDKLDSLIKPPECNNDVNLELRQRNRGDLTADTVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPNQEDGNTTEEFDSFRIFRLVGCALLAFGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLNYWGSEVP",
"proteome": "UP000245341",
"gene": "CAMLG",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0c3e162740490677398d7c4defb23e40fe496de4",
"counters": {
"domain_architectures": 964,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 964
}
}
}