GET /api/protein/UniProt/A0A2U3WQF8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2U3WQF8",
        "id": "A0A2U3WQF8_ODORO",
        "source_organism": {
            "taxId": "9708",
            "scientificName": "Odobenus rosmarus divergens",
            "fullName": "Odobenus rosmarus divergens (Pacific walrus)"
        },
        "name": "Guanine nucleotide exchange factor VAV2",
        "description": [
            "Guanine nucleotide exchange factor for the Rho family of Ras-related GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly"
        ],
        "length": 839,
        "sequence": "MEQWRQCGRWLIDCKVLPPNHRVVWPSAAVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHHVAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVRQPMKMGMSEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMTPLRLVLSPADMTAIFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEYGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRRGYSYELKEVIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACRMFLRGTFYQGYLCTKCGVGAHKECLEVTPPCKISSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVIELLRGDPESQWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHTSGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERAASRASSRSPVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGEANGRIGWFPSTYVEEEGVQ",
        "proteome": "UP000245340",
        "gene": "VAV2",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005085",
                "name": "guanyl-nucleotide exchange factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1a7fea9b74d33058e192485bfa7367c54c2a5a66",
        "counters": {
            "domain_architectures": 1087,
            "entries": 60,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 12,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 7,
                "cathgene3d": 6,
                "cdd": 7,
                "ssf": 5,
                "smart": 6,
                "pfam": 6,
                "panther": 1,
                "prosite": 2,
                "prints": 2,
                "interpro": 18
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1087
        }
    }
}