GET /api/protein/UniProt/A0A2U3W7S2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2U3W7S2",
        "id": "A0A2U3W7S2_ODORO",
        "source_organism": {
            "taxId": "9708",
            "scientificName": "Odobenus rosmarus divergens",
            "fullName": "Odobenus rosmarus divergens (Pacific walrus)"
        },
        "name": "Bcl-2 Bcl-2 homology region 1-3 domain-containing protein",
        "description": [
            "Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis"
        ],
        "length": 350,
        "sequence": "MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGRRLLASGKEATARREVGGGEAGAVIGGSAGASAPATLAPDARRVARPSPIGAEGPDVTATPPRLLFFEPTRRASPPEEMEGPAADAIMSAEAELDGYEPEPLGRRPAVLPLLELVGEASSGPCRDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSGAAGRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGVRNVLLAFAGVAGVGAGFAYLIR",
        "proteome": "UP000245340",
        "gene": "MCL1",
        "go_terms": [
            {
                "identifier": "GO:0042981",
                "name": "regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "92ba116244fc0fb74889d66f6dfb45f495b68e25",
        "counters": {
            "domain_architectures": 8374,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 2,
                "prosite": 3,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8374
        }
    }
}