GET /api/protein/UniProt/A0A2U3W7S2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2U3W7S2",
"id": "A0A2U3W7S2_ODORO",
"source_organism": {
"taxId": "9708",
"scientificName": "Odobenus rosmarus divergens",
"fullName": "Odobenus rosmarus divergens (Pacific walrus)"
},
"name": "Bcl-2 Bcl-2 homology region 1-3 domain-containing protein",
"description": [
"Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis"
],
"length": 350,
"sequence": "MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGRRLLASGKEATARREVGGGEAGAVIGGSAGASAPATLAPDARRVARPSPIGAEGPDVTATPPRLLFFEPTRRASPPEEMEGPAADAIMSAEAELDGYEPEPLGRRPAVLPLLELVGEASSGPCRDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSGAAGRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGVRNVLLAFAGVAGVGAGFAYLIR",
"proteome": "UP000245340",
"gene": "MCL1",
"go_terms": [
{
"identifier": "GO:0042981",
"name": "regulation of apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "92ba116244fc0fb74889d66f6dfb45f495b68e25",
"counters": {
"domain_architectures": 8374,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"pfam": 1,
"prints": 2,
"prosite": 3,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8374
}
}
}