GET /api/protein/UniProt/A0A2T8LF82/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2T8LF82",
"id": "A0A2T8LF82_SALET",
"source_organism": {
"taxId": "192955",
"scientificName": "Salmonella enterica subsp. enterica serovar Kentucky",
"fullName": "Salmonella enterica subsp. enterica serovar Kentucky"
},
"name": "Flagellar protein FliL",
"description": [
"Controls the rotational direction of flagella during chemotaxis"
],
"length": 155,
"sequence": "MTDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRMQQQPTTNAKAEPAPPPAPVFFALDTFTVNLGDADRVLYIGVTLRLKDEATRARLNEYLPEVRSRLLLLFSRQNAAELSTEAGKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFILR",
"proteome": null,
"gene": "fliL",
"go_terms": [
{
"identifier": "GO:0006935",
"name": "chemotaxis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0071973",
"name": "bacterial-type flagellum-dependent cell motility",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009425",
"name": "bacterial-type flagellum basal body",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c9da8ec1356cc8d079c3ad64865353630524aad9",
"counters": {
"domain_architectures": 14576,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 14576
}
}
}