General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2T3ZCT0",
        "id": "A0A2T3ZCT0_TRIA4",
        "source_organism": {
            "taxId": "1042311",
            "scientificName": "Trichoderma asperellum (strain ATCC 204424 / CBS 433.97 / NBRC 101777)",
            "fullName": "Trichoderma asperellum (strain ATCC 204424 / CBS 433.97 / NBRC 101777)"
        },
        "name": "Uncharacterized protein",
        "description": null,
        "length": 240,
        "sequence": "MTVSSSSKIVLVTGANQGIGFEIAKSLSSKPGYHVLVGSRDTQRGIDAAQQLQEQGFSAEPIAIDITSDKSIAEAVQQVTSKFGRLDVLVNNAGICLHDEMTSAPSLRNFHETFSVNTFGATITTEAFIPLLTASAAPRIVFVSSSMGSLTQRWGYPAGWPIYCSSKAALNMMMLHYAFKYKDAGWKINATCPGYCATNLNGFSGKDTPADGALNAVRLATLGDDGETGTFSNKEGTLPW",
        "proteome": "UP000240493",
        "gene": "M441DRAFT_68135",
        "go_terms": [
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a0c95b509a3fe852564663f48768d986938c9d65",
        "counters": {
            "domain_architectures": 599639,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 599639
        }
    }
}