GET /api/protein/UniProt/A0A2S8D4R0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2S8D4R0",
        "id": "A0A2S8D4R0_SHIDY",
        "source_organism": {
            "taxId": "622",
            "scientificName": "Shigella dysenteriae",
            "fullName": "Shigella dysenteriae"
        },
        "name": "Nucleoside triphosphatase NudI",
        "description": [
            "Catalyzes the hydrolysis of nucleoside triphosphates, with a preference for pyrimidine deoxynucleoside triphosphates (dUTP, dTTP and dCTP)"
        ],
        "length": 141,
        "sequence": "MRQRTIVCPLIQNDGAYLLCKMADDRGVFPCQWALSGGGVEYGERIEEALRREIREELGEQLLLTEITPWTFSDDIRTKTYADGRKEEIYMIYLIFDCVSANREVKINEEFQDYAWVKPEDLVHYDLNVATRKTLRLKGLL",
        "proteome": null,
        "gene": "nudI",
        "go_terms": [
            {
                "identifier": "GO:0016818",
                "name": "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "752b3b6d9807717ea1f029db1420a2538cb188ca",
        "counters": {
            "domain_architectures": 250306,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 250306
        }
    }
}