HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2S8D4R0",
"id": "A0A2S8D4R0_SHIDY",
"source_organism": {
"taxId": "622",
"scientificName": "Shigella dysenteriae",
"fullName": "Shigella dysenteriae"
},
"name": "Nucleoside triphosphatase NudI",
"description": [
"Catalyzes the hydrolysis of nucleoside triphosphates, with a preference for pyrimidine deoxynucleoside triphosphates (dUTP, dTTP and dCTP)"
],
"length": 141,
"sequence": "MRQRTIVCPLIQNDGAYLLCKMADDRGVFPCQWALSGGGVEYGERIEEALRREIREELGEQLLLTEITPWTFSDDIRTKTYADGRKEEIYMIYLIFDCVSANREVKINEEFQDYAWVKPEDLVHYDLNVATRKTLRLKGLL",
"proteome": null,
"gene": "nudI",
"go_terms": [
{
"identifier": "GO:0016818",
"name": "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "752b3b6d9807717ea1f029db1420a2538cb188ca",
"counters": {
"domain_architectures": 250306,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 250306
}
}
}