GET /api/protein/UniProt/A0A2S7XMF5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2S7XMF5",
        "id": "A0A2S7XMF5_9GAMM",
        "source_organism": {
            "taxId": "61644",
            "scientificName": "Chromatium okenii",
            "fullName": "Chromatium okenii"
        },
        "name": "7-carboxy-7-deazaguanine synthase",
        "description": [
            "Catalyzes the complex heterocyclic radical-mediated conversion of 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) to 7-carboxy-7-deazaguanine (CDG), a step common to the biosynthetic pathways of all 7-deazapurine-containing compounds"
        ],
        "length": 210,
        "sequence": "MTYHLKEMFYSLQGEGAQVGRPAIFCRFTGCNLWSGREVDRAQAKCRFCDTDFRGTNGINGGRYADVDALVQKICALWPNTAVRPYIICTGGEPLLQLDAALIAALRQRECEIAVETNGTLPAPAGLNWICVSPKAGAPLRQTSGDELKLVYPQYAALPEQFTGLAFRYFFLQPLADANCAAHTAQAIDYCKSHPQWRLSIQTHKLLDIP",
        "proteome": "UP000239936",
        "gene": "queE",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008616",
                "name": "tRNA queuosine(34) biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1d7b556ab52b38ef5d2d40d0fa5e3282ff6cdc48",
        "counters": {
            "domain_architectures": 140037,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "sfld": 2,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140037
        }
    }
}