HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2S7XMF5",
"id": "A0A2S7XMF5_9GAMM",
"source_organism": {
"taxId": "61644",
"scientificName": "Chromatium okenii",
"fullName": "Chromatium okenii"
},
"name": "7-carboxy-7-deazaguanine synthase",
"description": [
"Catalyzes the complex heterocyclic radical-mediated conversion of 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) to 7-carboxy-7-deazaguanine (CDG), a step common to the biosynthetic pathways of all 7-deazapurine-containing compounds"
],
"length": 210,
"sequence": "MTYHLKEMFYSLQGEGAQVGRPAIFCRFTGCNLWSGREVDRAQAKCRFCDTDFRGTNGINGGRYADVDALVQKICALWPNTAVRPYIICTGGEPLLQLDAALIAALRQRECEIAVETNGTLPAPAGLNWICVSPKAGAPLRQTSGDELKLVYPQYAALPEQFTGLAFRYFFLQPLADANCAAHTAQAIDYCKSHPQWRLSIQTHKLLDIP",
"proteome": "UP000239936",
"gene": "queE",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008616",
"name": "tRNA queuosine(34) biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1d7b556ab52b38ef5d2d40d0fa5e3282ff6cdc48",
"counters": {
"domain_architectures": 140037,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"sfld": 2,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140037
}
}
}