General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2S7X885",
        "id": "A0A2S7X885_9GAMM",
        "source_organism": {
            "taxId": "566293",
            "scientificName": "Aliivibrio sifiae",
            "fullName": "Aliivibrio sifiae"
        },
        "name": "Pyrimidine/purine nucleoside phosphorylase",
        "description": [
            "Catalyzes the phosphorolysis of diverse nucleosides, yielding D-ribose 1-phosphate and the respective free bases. Can use uridine, adenosine, guanosine, cytidine, thymidine, inosine and xanthosine as substrates. Also catalyzes the reverse reactions"
        ],
        "length": 93,
        "sequence": "MLSVNSYFEDKVKSIGFEQNSNAISVGVMLPGNYTFGTNAAEKMTVVTGALEIKRTTDVDWVVFSSGESFSVEGNSSFDVKVSIETAYLCEYL",
        "proteome": "UP001156660",
        "gene": "ppnP",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cb075b3ccb9d7f5677132b0cb821b74f2816dd8b",
        "counters": {
            "domain_architectures": 5497,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5497
        }
    }
}