General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2S7D0I2",
        "id": "A0A2S7D0I2_9XANT",
        "source_organism": {
            "taxId": "56457",
            "scientificName": "Xanthomonas pisi",
            "fullName": "Xanthomonas pisi"
        },
        "name": "Sec-independent protein translocase protein TatA",
        "description": [
            "Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system"
        ],
        "length": 75,
        "sequence": "MGGFSIWHWLIVLVIVLLVFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGKLGDDSRTAEQAREAQAERDRDAR",
        "proteome": "UP000238191",
        "gene": "tatA",
        "go_terms": [
            {
                "identifier": "GO:0043953",
                "name": "protein transport by the Tat complex",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015031",
                "name": "protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8e9933fb82f0f1a021a5c55eb56f620d16af2308",
        "counters": {
            "domain_architectures": 47020,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ncbifam": 3,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 47020
        }
    }
}