HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2S6IEW2",
"id": "A0A2S6IEW2_9FLAO",
"source_organism": {
"taxId": "191564",
"scientificName": "Nonlabens xylanidelens",
"fullName": "Nonlabens xylanidelens"
},
"name": "Energy-dependent translational throttle protein EttA",
"description": [
"A translation factor that gates the progression of the 70S ribosomal initiation complex (IC, containing tRNA(fMet) in the P-site) into the translation elongation cycle by using a mechanism sensitive to the ATP/ADP ratio. Binds to the 70S ribosome E-site where it modulates the state of the translating ribosome during subunit translocation. ATP hydrolysis probably frees it from the ribosome, which can enter the elongation phase"
],
"length": 563,
"sequence": "MSDDKQVIFSMSGLSKTYQSTGKQVLKNIHLSFFYGAKIGILGLNGSGKSTLMKIIAGIEKNYQGDINFLPGYNVGYLEQEPQLDETKTVMEIVREGVAETVAVLDEYNKINDDFGLEEVYTDADKMEKLMNRQAVLQDKIDALNAWELDTKLEIAMDALRTPPGDAEIKNLSGGERRRVALCRLLLQQPEILLLDEPTNHLDAESVLWLEQHLAQYKGTVIAVTHDRYFLDNVAGWILELDRGEGIPWKGNYSSWLEQKGDRLAKEEKSESKRQKTLKRELDWVRQGAKGRQTKQKARLSNYDKLLNEDQKVKEEKLEIYIPNGPRLGTNVIEANGVSKAFGDKLLYEDLNFVLPQNGIVGIIGPNGAGKTTIFKMIMDQEQPDKGSFTVGETVQLAYVDQSHSNIDANKSIWENFSDGQDMIMMGGKMVNSRAYLSRFNFSGSEQNKKVATLSGGERNRLHLAMTLKEEGNVLLLDEPTNDLDVNTLRALEEGLDNFAGCAVIISHDRWFLDRVCTHIIAFEGDSQIYSFEGSFTEYEENKKKRLGDHAPKRIRYKKLTRD",
"proteome": "UP000239002",
"gene": "ettA",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016887",
"name": "ATP hydrolysis activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045900",
"name": "negative regulation of translational elongation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "23709cf00441ec01b7e5c4492496e64144c74742",
"counters": {
"domain_architectures": 66202,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"pfam": 2,
"smart": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 66202
}
}
}