GET /api/protein/UniProt/A0A2S6IEW2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2S6IEW2",
        "id": "A0A2S6IEW2_9FLAO",
        "source_organism": {
            "taxId": "191564",
            "scientificName": "Nonlabens xylanidelens",
            "fullName": "Nonlabens xylanidelens"
        },
        "name": "Energy-dependent translational throttle protein EttA",
        "description": [
            "A translation factor that gates the progression of the 70S ribosomal initiation complex (IC, containing tRNA(fMet) in the P-site) into the translation elongation cycle by using a mechanism sensitive to the ATP/ADP ratio. Binds to the 70S ribosome E-site where it modulates the state of the translating ribosome during subunit translocation. ATP hydrolysis probably frees it from the ribosome, which can enter the elongation phase"
        ],
        "length": 563,
        "sequence": "MSDDKQVIFSMSGLSKTYQSTGKQVLKNIHLSFFYGAKIGILGLNGSGKSTLMKIIAGIEKNYQGDINFLPGYNVGYLEQEPQLDETKTVMEIVREGVAETVAVLDEYNKINDDFGLEEVYTDADKMEKLMNRQAVLQDKIDALNAWELDTKLEIAMDALRTPPGDAEIKNLSGGERRRVALCRLLLQQPEILLLDEPTNHLDAESVLWLEQHLAQYKGTVIAVTHDRYFLDNVAGWILELDRGEGIPWKGNYSSWLEQKGDRLAKEEKSESKRQKTLKRELDWVRQGAKGRQTKQKARLSNYDKLLNEDQKVKEEKLEIYIPNGPRLGTNVIEANGVSKAFGDKLLYEDLNFVLPQNGIVGIIGPNGAGKTTIFKMIMDQEQPDKGSFTVGETVQLAYVDQSHSNIDANKSIWENFSDGQDMIMMGGKMVNSRAYLSRFNFSGSEQNKKVATLSGGERNRLHLAMTLKEEGNVLLLDEPTNDLDVNTLRALEEGLDNFAGCAVIISHDRWFLDRVCTHIIAFEGDSQIYSFEGSFTEYEENKKKRLGDHAPKRIRYKKLTRD",
        "proteome": "UP000239002",
        "gene": "ettA",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016887",
                "name": "ATP hydrolysis activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045900",
                "name": "negative regulation of translational elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "23709cf00441ec01b7e5c4492496e64144c74742",
        "counters": {
            "domain_architectures": 66202,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 66202
        }
    }
}