General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2S5FH73",
        "id": "A0A2S5FH73_AERJA",
        "source_organism": {
            "taxId": "650",
            "scientificName": "Aeromonas jandaei",
            "fullName": "Aeromonas jandaei"
        },
        "name": "3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase",
        "description": [
            "Necessary for the introduction of cis unsaturation into fatty acids. Catalyzes the dehydration of (3R)-3-hydroxydecanoyl-ACP to E-(2)-decenoyl-ACP and then its isomerization to Z-(3)-decenoyl-ACP. Can catalyze the dehydratase reaction for beta-hydroxyacyl-ACPs with saturated chain lengths up to 16:0, being most active on intermediate chain length"
        ],
        "length": 186,
        "sequence": "MTVDNSTLEARLSLCEQGKNSFTREELLACSRGELFGEGNSQLPAPNMLMMDRIVKINDNGGEHGKGEILAELDITPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLGWKGGPGKGRALGVGEVKFTGQILPTAKKVTYKITFKRVINRKLVMGIADGVVEVDGRPIYSATDLKVGLFQDTTAF",
        "proteome": null,
        "gene": "fabA",
        "go_terms": [
            {
                "identifier": "GO:0019171",
                "name": "(3R)-hydroxyacyl-[acyl-carrier-protein] dehydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6eee872930b0f833d0a363bc10e4597494e29e33",
        "counters": {
            "domain_architectures": 27313,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27313
        }
    }
}