GET /api/protein/UniProt/A0A2S0VL88/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "A0A2S0VL88",
"id": "A0A2S0VL88_9ALTE",
"source_organism": {
"taxId": "2172099",
"scientificName": "Saccharobesus litoralis",
"fullName": "Saccharobesus litoralis"
},
"name": "thioredoxin-dependent peroxiredoxin",
"description": [
"Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events"
],
"length": 156,
"sequence": "MNPIQPGTVAPLFSLKNQNDETINLADYIGKNKVVVYFYPKASTPGCTVQACGLRDSKTELDALNVKVFGLSPDPVKRISNFVTKQELNFDLLADEDHATADAYGVWGLKKFMGREYDGIHRISFLIGLDGKIEHVFNKFKTKDHHEVVLDYLKQS",
"proteome": "UP000244441",
"gene": "C2869_00270",
"go_terms": [
{
"identifier": "GO:0016209",
"name": "antioxidant activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a21e48547e25de76b0bffd3fe920a04fbf2958a9",
"counters": {
"domain_architectures": 98778,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 98778
}
}
}