General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2S0RC98",
        "id": "A0A2S0RC98_9FLAO",
        "source_organism": {
            "taxId": "2162713",
            "scientificName": "Flavobacterium magnum",
            "fullName": "Flavobacterium magnum"
        },
        "name": "Transcriptional regulator MntR",
        "description": [
            "In the presence of manganese, represses expression of mntH and mntS. Up-regulates expression of mntP"
        ],
        "length": 217,
        "sequence": "MTFSEENYLKTIYHLTILTDSGVSTNAIADKMETKASSVTDMLKKLAEKDLVHYKKYQGVSLTDNGRLAAKMIVRKHRLWEVFLVEKLDFAWDEVHDIAEQLEHIKSEKLINKLDDFLGNPTEDPHGDPIPDANGRIIKIEKQLLSELNENQSGVCVGVKDTSSEFLQYLDKLGIALGAEIKVLVKESFDQSLRIAIGTKENAISSKIASNLFVQRS",
        "proteome": "UP000244193",
        "gene": "HYN48_03370",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046914",
                "name": "transition metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e0f378aca321f7f0cb76b52b50098711568c19b4",
        "counters": {
            "domain_architectures": 8699,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 3,
                "profile": 1,
                "cathgene3d": 3,
                "pfam": 3,
                "smart": 2,
                "panther": 1,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8699
        }
    }
}