GET /api/protein/UniProt/A0A2R9A502/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2R9A502",
        "id": "A0A2R9A502_PANPA",
        "source_organism": {
            "taxId": "9597",
            "scientificName": "Pan paniscus",
            "fullName": "Pan paniscus (Pygmy chimpanzee)"
        },
        "name": "Pyrroline-5-carboxylate reductase",
        "description": [
            "Oxidoreductase that catalyzes the last step in proline biosynthesis, which corresponds to the reduction of pyrroline-5-carboxylate (P5C) to L-proline using NAD(P)H. Proline is synthesized from either glutamate or ornithine; both are converted to P5C, and then to proline via pyrroline-5-carboxylate reductases (PYCRs). PYCR3 is exclusively linked to the biosynthesis of proline from ornithine"
        ],
        "length": 296,
        "sequence": "MVHPALGSWGQEGAQDGPGVAEPERPSELLPLLSVPSYPTPSPTPLPFPFFPGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK",
        "proteome": "UP000240080",
        "gene": "PYCR3",
        "go_terms": [
            {
                "identifier": "GO:0004735",
                "name": "pyrroline-5-carboxylate reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055129",
                "name": "L-proline biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6d5708f86fae1bd73c51d03ad2752b96a1edc21c",
        "counters": {
            "domain_architectures": 36407,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 36407
        }
    }
}