GET /api/protein/UniProt/A0A2R8ZB90/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2R8ZB90",
"id": "A0A2R8ZB90_PANPA",
"source_organism": {
"taxId": "9597",
"scientificName": "Pan paniscus",
"fullName": "Pan paniscus (Pygmy chimpanzee)"
},
"name": "Diablo IAP-binding mitochondrial protein",
"description": [
"Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/BRUCE by inhibiting its binding to caspases"
],
"length": 186,
"sequence": "MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITTRNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED",
"proteome": "UP000240080",
"gene": "DIABLO",
"go_terms": [
{
"identifier": "GO:0006915",
"name": "apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005739",
"name": "mitochondrion",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f4a814e5ebc7e419702679c57fa452279ab8112d",
"counters": {
"domain_architectures": 1425,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1425
}
}
}