General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2N7THL2",
        "id": "A0A2N7THL2_9GAMM",
        "source_organism": {
            "taxId": "1387883",
            "scientificName": "Halomonas heilongjiangensis",
            "fullName": "Halomonas heilongjiangensis"
        },
        "name": "Branched-chain-amino-acid aminotransferase",
        "description": [
            "Acts on leucine, isoleucine and valine",
            "Involved in the biosynthesis of p-aminobenzoate (PABA), a precursor of tetrahydrofolate. Converts 4-amino-4-deoxychorismate into 4-aminobenzoate (PABA) and pyruvate"
        ],
        "length": 322,
        "sequence": "MTPLYDRDGWLWHDGEWLAWRDARTHLLTHTLHYGMGCFEGVRAYHGERGTHLFRVAEHTRRLADSAHALDMPLDFSEAELIEAQRLCLKKNGLANAYLKPTVYFGAEGLGLRAKGLTVHVMIAAWDLGDYISPEAASIGLRALTSSWSRHHVNISLCRAKTNGHYVNSMLALNTAVKAGFDEALMLDPEGYVAEASAANVFLLRDGVLHTPEITSCLQGITRDSVIRLARDALGLEVRERRITRDELYTADEAFVTGTAAELLPLRELDGRHIGARAGAPPPGRPIAEGSVTARLQRLYRRVTRGELGDDLVAFRNWLTPA",
        "proteome": "UP000235346",
        "gene": "ilvE",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004084",
                "name": "branched-chain-amino-acid transaminase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009081",
                "name": "branched-chain amino acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c8cf9b0777e925f72b88b5d6f7ebb434bd00bc5",
        "counters": {
            "domain_architectures": 76076,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 76076
        }
    }
}