GET /api/protein/UniProt/A0A2M9YS65/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2M9YS65",
        "id": "A0A2M9YS65_9LEPT",
        "source_organism": {
            "taxId": "2023186",
            "scientificName": "Leptospira adleri",
            "fullName": "Leptospira adleri"
        },
        "name": "4-hydroxybenzoate brominase (decarboxylating)",
        "description": [
            "Acts as a Baeyer-Villiger monooxygenase on a broad range of substrates. Catalyzes the insertion of an oxygen atom into a carbon-carbon bond adjacent to a carbonyl, which converts ketones to esters. Active on diverse carbonyl compounds, whereas soft nucleophiles are mostly non- or poorly reactive. In contrast with other forms of FMO it is non- or poorly active on 'classical' substrates such as drugs, pesticides, and dietary components containing soft nucleophilic heteroatoms. Able to oxidize drug molecules bearing a carbonyl group on an aliphatic chain, such as nabumetone and pentoxifylline. Also, in the absence of substrates, shows slow but yet significant NADPH oxidase activity. Acts as a positive modulator of cholesterol biosynthesis as well as glucose homeostasis, promoting metabolic aging via pleiotropic effects"
        ],
        "length": 479,
        "sequence": "MSSLPRVCVIGAGSSGITVCKALKDKGIPFDCYEAGSEVGGNWRFNNDNKMSNIYKSLHINTHRDRMEYRDYPMPKSYADYPGHQRILEYFIDYVNHFGLRKNIHFKNPVVHADYQDDGTWLITTGDGKQKFYDALVVSNGHHWSQRWPDPPFPGKFTGKIIHSHSYVDPDNPIKLTGKRVVVLGMGNSAMDITVELCRPGVASKVFLAARRGAYIIPNYLFGKPLDKSTEMIPVHTPFWLKSFIMGLVLRFGVGKVEDFGLQKPDHKPGAAHPTISQDILVRLGRGDVTPKPNIESYNGNKVRFVDGSEEEVDAVIYCTGYNVKFPFFDENLISAKDNHLPLFHRMIKPEYNNLFFVGLYQPLGAIMPLAEFQGKWISEYLTGNYQLPTEEEMNHAIEKYESQMKKRYVASTRHTMQVDFEDFLYDMKNELKKGVQRAKKNGNAVNVEAIAEHKQVSKNGVGSSKHGVKKKTRVLAKV",
        "proteome": "UP000232149",
        "gene": "CH380_04720",
        "go_terms": [
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004499",
                "name": "N,N-dimethylaniline monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cea59a56e6d7a75ef5681f4b224bfc6672b76e85",
        "counters": {
            "domain_architectures": 47203,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 47203
        }
    }
}