HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2M9YS65",
"id": "A0A2M9YS65_9LEPT",
"source_organism": {
"taxId": "2023186",
"scientificName": "Leptospira adleri",
"fullName": "Leptospira adleri"
},
"name": "4-hydroxybenzoate brominase (decarboxylating)",
"description": [
"Acts as a Baeyer-Villiger monooxygenase on a broad range of substrates. Catalyzes the insertion of an oxygen atom into a carbon-carbon bond adjacent to a carbonyl, which converts ketones to esters. Active on diverse carbonyl compounds, whereas soft nucleophiles are mostly non- or poorly reactive. In contrast with other forms of FMO it is non- or poorly active on 'classical' substrates such as drugs, pesticides, and dietary components containing soft nucleophilic heteroatoms. Able to oxidize drug molecules bearing a carbonyl group on an aliphatic chain, such as nabumetone and pentoxifylline. Also, in the absence of substrates, shows slow but yet significant NADPH oxidase activity. Acts as a positive modulator of cholesterol biosynthesis as well as glucose homeostasis, promoting metabolic aging via pleiotropic effects"
],
"length": 479,
"sequence": "MSSLPRVCVIGAGSSGITVCKALKDKGIPFDCYEAGSEVGGNWRFNNDNKMSNIYKSLHINTHRDRMEYRDYPMPKSYADYPGHQRILEYFIDYVNHFGLRKNIHFKNPVVHADYQDDGTWLITTGDGKQKFYDALVVSNGHHWSQRWPDPPFPGKFTGKIIHSHSYVDPDNPIKLTGKRVVVLGMGNSAMDITVELCRPGVASKVFLAARRGAYIIPNYLFGKPLDKSTEMIPVHTPFWLKSFIMGLVLRFGVGKVEDFGLQKPDHKPGAAHPTISQDILVRLGRGDVTPKPNIESYNGNKVRFVDGSEEEVDAVIYCTGYNVKFPFFDENLISAKDNHLPLFHRMIKPEYNNLFFVGLYQPLGAIMPLAEFQGKWISEYLTGNYQLPTEEEMNHAIEKYESQMKKRYVASTRHTMQVDFEDFLYDMKNELKKGVQRAKKNGNAVNVEAIAEHKQVSKNGVGSSKHGVKKKTRVLAKV",
"proteome": "UP000232149",
"gene": "CH380_04720",
"go_terms": [
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004499",
"name": "N,N-dimethylaniline monooxygenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cea59a56e6d7a75ef5681f4b224bfc6672b76e85",
"counters": {
"domain_architectures": 47203,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pirsf": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 47203
}
}
}