HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2M8W0W1",
"id": "A0A2M8W0W1_9RHOB",
"source_organism": {
"taxId": "420999",
"scientificName": "Yoonia maricola",
"fullName": "Yoonia maricola"
},
"name": "Pseudouridine synthase",
"description": [
"Dual specificity enzyme that catalyzes the synthesis of pseudouridine from uracil-746 in 23S ribosomal RNA and from uracil-32 in the anticodon stem and loop of transfer RNAs",
"Responsible for synthesis of pseudouridine from uracil"
],
"length": 215,
"sequence": "MSNDYNPPQDPLAILHDDHEVLLVDKPSGLLSVPGKGEHLSDCLITRVQKVFPTALLVHRLDRDTSGVMIFALTPHAQRHLGLQFEKRQTKKTYVARVWGEMAEKTGTVDLPLIVDWPNRPLQMVDHENGKQAVTDWRVIRARDGETRVRLMPRTGRSHQLRVHMLALGHPILGDPFYAEGTARDYPRLMLHSETLQFRHPDGGQGIRITAKAPF",
"proteome": "UP000228531",
"gene": "BC777_3610",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009982",
"name": "pseudouridine synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0001522",
"name": "pseudouridine synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009451",
"name": "RNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7a8b2c7931b32bef9a49c533034053867e5cf2c1",
"counters": {
"domain_architectures": 77605,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 77605
}
}
}