General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2M4CKL9",
        "id": "A0A2M4CKL9_ANODA",
        "source_organism": {
            "taxId": "43151",
            "scientificName": "Anopheles darlingi",
            "fullName": "Anopheles darlingi (Mosquito)"
        },
        "name": "Facilitated trehalose transporter Tret1",
        "description": [
            "High-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph"
        ],
        "length": 412,
        "sequence": "MCFPIGYMMKIIGRKWSMLAMVLPLLLGWLLIIFADNVAMLLVGRLFLGIGGGAFCVAAPTYTAEIAQPSVRGTLGTFFQLMVTVGILFVYAVGSGVDVQVLSIICGVIPLAFGAIFFFMPESPYYFVEKGRLSDASKSLKWLRGSNYDENAELEDMKQQDVKQKAEAIRMVDAFRQKATIRALIISLGLMFFQQLSGINAVIFYNSGIFKSANGGEEMSAAPIIVGGIQVVATLAASAVVDKVGRRILLMVSDFMMAVSTILLAVYFQLKQDDPSKVSDLNWLAVLAVCLFIAMFSIGYGPVPWLMVGELFANNVKAFASPIAGVFNWLLAFLVTKVFTNLTDAMGEAGVFWLFSGISLVGTVFVYLLVPETKGKSLVEIQRVLGGEKLDGTDRQNDESNATDANAANPVM",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051119",
                "name": "sugar transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008643",
                "name": "carbohydrate transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "03fa97b454336937c9960a7f5034cde92ca2cdaa",
        "counters": {
            "domain_architectures": 276159,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 276159
        }
    }
}